ATP synthase F(1) sector subunit delta MSDSTTIARPYAKAIFEHALAEKKLSEWSEYLTLLAQVVLTPQATQFIANPASTDEQQIELLIEVCGSKFKKNDALNNLIKLLTTNKRLMLLPEIEALYEVYRAEQEKILEVDVVSYSELTPAQQQRLSESLSQRLSRKVSLKISIDPSLLGGALIRAGDLVIDGSVRGKLNMLGTSLAA This protein is part of the stalk that links CF(0) to CF(1). It either transmits conformational changes from CF(0) to CF(1) or is implicated in proton conduction (By similarity). F-type ATPase subunit delta ATPD_LEGPH 180 lpg2985 atpH F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation (By similarity). ATP synthase subunit delta